PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco030790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family FAR1
Protein Properties Length: 460aa    MW: 51512.2 Da    PI: 9.8231
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco030790.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR127.51.1e-08184228247
         FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk 47 
                  fYn+YA++ GFsvrk +  ++ ++g++ +r f Cs+e k++ ++++
  Aco030790.1 184 FYNKYAQRKGFSVRKGHLGRR-KDGSVRNRVFLCSNEVKSAFSEDA 228
                  9****************9997.8899***********998876655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031018.2E-6184228IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
RRWIKAPRDA NILRLRSFVR NDGRRILSVA YLEFLYGLSR RGFPPSPPSG GHGLRAPPPP  60
SLGAARPLPQ TLSNRFAGRG VLFLNFLRME LSGSSLDNES IETVEDSSDR EEDDGAIHRR  120
PMGHDSRENM AVQEYQALKD VEACKTSTLT DPGVREKQKA AIVNSQLEPE VGMAFHSEDR  180
AYLFYNKYAQ RKGFSVRKGH LGRRKDGSVR NRVFLCSNEV KSAFSEDALQ IYENELDKLM  240
AKVEHVLHMA PLNRPADDED VTVVDNMQHN TLEARKKKRG RKPKSESEKR RKKPQTIISS  300
LDTTTLQQPP QNTVNARQNV TSAQVMVDDP SRIQSYHQNG PTSYCNPIPM QPTGCPFPQE  360
TVIPTQESFL PTHGIFDHTI APQGSSNPNM AWCSARGPVG IPMPVLPGQS NFVNWVAQPR  420
SIPNVTMPHN HLDHPMHSTV PTHHQSMSRK LNFDINKGS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1274292RKKKRGRKPKSESEKRRKK
2276292KKRGRKPKSESEKRRKK
3277293KRGRKPKSESEKRRKKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008776701.14e-86PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_008778589.14e-86PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_010923773.14e-82PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLM0RZE32e-78M0RZE3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P12850_0016e-78(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18960.14e-10FAR1-related sequence 12